PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc03900.1.g00090.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family HSF
Protein Properties Length: 483aa    MW: 51553.1 Da    PI: 8.0151
Description HSF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc03900.1.g00090.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HSF_DNA-bind78.61e-24143202261
                                     HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHTT CS
                    HSF_DNA-bind   2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmYg 61 
                                     Fl+k+ye+++d+++++++sw    nsfvv+++ efa+++LpkyFkhsnf+SFvRQLn+Y 
  Zmw_sc03900.1.g00090.1.am.mkhc 143 FLMKTYEMVDDPATDDVVSWGPGDNSFVVWNTPEFARDLLPKYFKHSNFSSFVRQLNTYA 202
                                     9********************999***********************************6 PP

2Myb_DNA-binding30.39.7e-10409454345
                                     SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHH CS
                 Myb_DNA-binding   3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwq 45 
                                      W+  E e++ +a + +G++   +W +Ia+ +g g+t+ ++k ++ 
  Zmw_sc03900.1.g00090.1.am.mkhc 409 TWSWSENERFENALATYGSDtpdRWQRIAAVVGGGKTADDVKRHYE 454
                                     7*******************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.107.4E-27137203IPR011991Winged helix-turn-helix DNA-binding domain
SMARTSM004156.5E-30139288IPR000232Heat shock factor (HSF)-type, DNA-binding
SuperFamilySSF467855.85E-24139207IPR011991Winged helix-turn-helix DNA-binding domain
PRINTSPR000565.1E-15143166IPR000232Heat shock factor (HSF)-type, DNA-binding
PfamPF004475.0E-21143205IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000565.1E-15181193IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000565.1E-15194206IPR000232Heat shock factor (HSF)-type, DNA-binding
PROSITE profilePS500906.876402457IPR017877Myb-like domain
SMARTSM007172.5E-8406459IPR001005SANT/Myb domain
PfamPF002493.8E-8408454IPR001005SANT/Myb domain
SuperFamilySSF466891.72E-9409456IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.5E-4409455IPR009057Homeodomain-like
CDDcd001672.97E-4414456No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005739Cellular Componentmitochondrion
GO:0009941Cellular Componentchloroplast envelope
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 483 aa     Download sequence    Send to blast
MGWAGPGHEW EINQTAHGRY SLFSLRNDKC MEGDDDASFS GGGAACSSPR SQGDRTRIAG  60
DPFLRAPPNP SRDPRPWPRR GRERAYGSRA EEMEGGVAAA AAAAAAASTV TTAVAPPVAP  120
APAATHAAVA NGGGAPTAPP PPFLMKTYEM VDDPATDDVV SWGPGDNSFV VWNTPEFARD  180
LLPKYFKHSN FSSFVRQLNT YATLKGRFDG DKATAATTLA VPAAGDLSFK ASATEANGPS  240
LSGLTLTLEK PGAFLVDVKP HNKDVRFQFM NSALVYDKRL SLTYTHSTSL ANDAAPPSRT  300
ALDCALAVDS ANKVSLSHTL GSGGCRVKYT YAHGIDRLTT FEPVFDTKAN AWEFAVTKKS  360
QGGDAVKGTY HASNKLLGLE WTKDSKAGAS FKVRSFSFEA MSSSRTTTTW SWSENERFEN  420
ALATYGSDTP DRWQRIAAVV GGGKTADDVK RHYEELELDI GGITEKGRRR QGRHGGGDGN  480
SNG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ldu_A2e-171412051882Heat shock factor protein 1
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP669022